PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00027.1.g06390.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 412aa    MW: 46339.1 Da    PI: 7.7178
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00027.1.g06390.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.5e-344397155
                         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                    kprl+WtpeLH+rFv+av+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Zjn_sc00027.1.g06390.1.sm.mkhc 43 KPRLKWTPELHQRFVDAVNQLGGADKATPKTVMRLMGIPGLTLYHLKSHLQKYRL 97
                                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.81540100IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-324198IPR009057Homeodomain-like
SuperFamilySSF466894.12E-174298IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-234398IPR006447Myb domain, plants
PfamPF002497.7E-104596IPR001005SANT/Myb domain
PfamPF143791.2E-20145191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MYHQHQGPSE LFTRTSFPME QQLFLRGGNS QGDSGLVLST DAKPRLKWTP ELHQRFVDAV  60
NQLGGADKAT PKTVMRLMGI PGLTLYHLKS HLQKYRLSKN LQAQANVSAT KNAIGCTPVT  120
DRIPGTSVPT MSGTSVIPQA EKTIPIGEAL QMQIEVQRQL NEQLEVQRHL QLQIKAQGKY  180
LQAVLEQAQE TLGKQNLGPA NLEDAKIKIS ELVSQVSNEC FSNATTDIKE NSNILRLEPQ  240
QIQFIESSTN TNLTEAEGFV KEHRLQNHGV LKAYDDRSLF CRKGSHENED RLTLNRSLSK  300
RRLAHLHNVK VYDKLEFVCG SEKEAPAEYI TPQKDSGGST ISSALGSKEG QAVKQSLEEQ  360
NYRKQAVEYQ RESKLLDFEN PYSGKKLDLN THNIDDNDQP YRHFDLNGFS WS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656404.10.0PREDICTED: uncharacterized protein LOC103635802
RefseqXP_008656405.10.0PREDICTED: uncharacterized protein LOC103635802
TrEMBLA0A0E0L4220.0A0A0E0L422_ORYPU; Uncharacterized protein
STRINGSb09g023830.10.0(Sorghum bicolor)
STRINGGRMZM2G701218_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122793137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.33e-98G2-like family protein